PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000707.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 255aa    MW: 28596.8 Da    PI: 7.3105
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000707.1_g00018.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.27.1e-3252107359
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              k rY+eC+kNhA+ +GghavDGCgEfmp+ ge g+ +alkCaAC+CHRnFHR+e ++
  Itr_sc000707.1_g00018.1  52 KPRYRECQKNHAVGIGGHAVDGCGEFMPA-GEFGSLDALKCAACNCHRNFHRKEINT 107
                              679*************************9.888********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.9E-2854105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.9E-3054105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2154104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.08455104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-28164235IPR009057Homeodomain-like
SuperFamilySSF466891.64E-16165234IPR009057Homeodomain-like
TIGRFAMsTIGR015651.0E-25173229IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEFEDQQHSG GNGTGPGYDS LSNSNSAHPR MPENDDGAGD LPVTEPPLQV RKPRYRECQK  60
NHAVGIGGHA VDGCGEFMPA GEFGSLDALK CAACNCHRNF HRKEINTAAL VPVGYHHHHR  120
APTGYLHHYH HHAPPLQRPL ALPSISGSAY REELEELDLE MDTATPNSGG ASKKRFRTKF  180
TEVQKAKMME LAERLGWRIQ KESEEAVEQF CSEYGVRRHV FKVWMHNNKH TVAKKTLEPN  240
NNNNSNQPNQ DPPRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-231722311675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802158.11e-83PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
RefseqXP_016462880.11e-83PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
SwissprotQ6YXH58e-72ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1C6691e-78M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606233e-78(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-64homeobox protein 22